PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0179s0040.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 320aa    MW: 36707.8 Da    PI: 6.5081
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0179s0040.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.75.3e-5451331128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka...eekewyfFskrdkkyatgkrknratksgy 82 
                             +ppGfrFhPt+eelv +yLk+k+++ k++l +vi ++d+y++ePwd+++  k      e++ewyfFs++d+ky+tg+r+nrat++g+
  SapurV1A.0179s0040.1.p   5 VPPGFRFHPTEEELVGYYLKRKIHSLKIDL-DVIVDIDLYNMEPWDIQArcK--LgydEQNEWYFFSHKDRKYPTGTRTNRATAAGF 88 
                             69****************************.99**************96342..3333677************************** PP

                     NAM  83 WkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                             Wkatg+dk+vls k++l+g++ktLvfykgrap+g+ktdW+mheyrl
  SapurV1A.0179s0040.1.p  89 WKATGRDKAVLS-KNRLIGMRKTLVFYKGRAPNGRKTDWIMHEYRL 133
                             ************.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.79E-603154IPR003441NAC domain
PROSITE profilePS5100558.455154IPR003441NAC domain
PfamPF023651.6E-286133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009735Biological Processresponse to cytokinin
GO:0009737Biological Processresponse to abscisic acid
GO:0009741Biological Processresponse to brassinosteroid
GO:0045491Biological Processxylan metabolic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:0050832Biological Processdefense response to fungus
GO:0071365Biological Processcellular response to auxin stimulus
GO:0090059Biological Processprotoxylem development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MESCVPPGFR FHPTEEELVG YYLKRKIHSL KIDLDVIVDI DLYNMEPWDI QARCKLGYDE  60
QNEWYFFSHK DRKYPTGTRT NRATAAGFWK ATGRDKAVLS KNRLIGMRKT LVFYKGRAPN  120
GRKTDWIMHE YRLQTSEHEP TQEEGWVVCR AFKKPSPNQR PGFEAWNHAY YVNNISHARP  180
PSFADTVTTT HTVHPSQSAS FHQPLGSDSD LISHQAFLDN NNQLVELPQL DSPSKLSTSF  240
ATKEGNLHQT SEDYDEERSN HSSQYIDWKS LDILLASQVN DSSAPSFPLQ NLPSMLQNYD  300
LAAGQQDHVS HFLDCFHDI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-49516017171NAC domain-containing protein 19
4dul_A2e-49516017171NAC domain-containing protein 19
1ut7_B2e-49516017171NO APICAL MERISTEM PROTEIN
1ut7_A2e-49516017171NO APICAL MERISTEM PROTEIN
1ut4_B2e-49516017171NO APICAL MERISTEM PROTEIN
1ut4_A2e-49516017171NO APICAL MERISTEM PROTEIN
3swp_D2e-49516020174NAC domain-containing protein 19
3swp_C2e-49516020174NAC domain-containing protein 19
3swp_B2e-49516020174NAC domain-containing protein 19
3swp_A2e-49516020174NAC domain-containing protein 19
3swm_D2e-49516020174NAC domain-containing protein 19
3swm_C2e-49516020174NAC domain-containing protein 19
3swm_B2e-49516020174NAC domain-containing protein 19
3swm_A2e-49516020174NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00017PBMTransfer from AT1G71930Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB5999380.0AB599938.1 Populus trichocarpa PtVNS07 mRNA for transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011038131.10.0PREDICTED: NAC domain-containing protein 7
SwissprotQ9C8W91e-123NAC30_ARATH; NAC domain-containing protein 30
TrEMBLF1T1120.0F1T112_POPTR; Transcription factor
STRINGPOPTR_0013s11740.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF71383247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71930.11e-106vascular related NAC-domain protein 7